missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Anticorps
  4. Anticorps primaires
  5. Tous les anticorps primaires
  6. APPBP2 Antibody, R&D Systems™

APPBP2 Antibody, R&D Systems™

Code produit 18601974 Tous les produits Bio Techne Produits
Modifier l'affichage
Click to view available options
Quantité:
100 μg
25 μg
Conditionnement:
100µL
25µL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Code produit Quantité Conditionnement
18601974 25 μg 25µL
18684504 100 μg 100µL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Les retours ne sont pas autorisés pour ce produit. Afficher la politique du retour.
Code produit 18601974 Fournisseur Novus Biologicals Code fournisseur NBP32131025ul
  • ONLINE EXCLUSIVE PRICE
    561.95 CHF
    481.95 CHF / 25 Mikroliter
    Sparen 80.00 CHF
    14% Rabatt
 Article restreint
Verfügbar ab: 01-12-2026
Ajouter au panier
Add to basket

missing translation for 'validMainframeMsg'

This item is not returnable. View return policy

Description

A Novus product, part of R&D Systems. Rabbit Polyclonal Antibody

APPBP2 Polyclonal specifically detects APPBP2 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.
TRUSTED_SUSTAINABILITY

Specifications

Antigène APPBP2
Applications Immunocytochemistry, Immunofluorescence
Classification Polyclonal
Conjugué Unconjugated
Dilution Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
Formule PBS, pH 7.2, 40% glycerol
Alias de gène amyloid beta precursor protein (cytoplasmic tail) binding protein 2, Amyloid beta precursor protein-binding protein 2, amyloid protein-binding protein 2, APP-BP2, KIAA0228HS.84084, PAT1amyloid beta precursor protein (cytoplasmic tail)-binding protein 2, Protein interacting with APP tail 1
Espèces hôtes Rabbit
Immunogène This antibody was developed against Recombinant Protein corresponding to amino acids: ALSVGHLASLYNYDMNQYENAEKLYLRSIAIGKKLFGEGYSGLEYDYRGLIKLYNSIGNYEKVFEYHNVLSNW
Méthode de purification Affinity purified
Quantité 25 μg
État réglementaire RUO
Disciplines de recherche Cancer
Primaire ou secondaire Primary
Identification génétique (Entrez) 10513
Espèces cibles Human
Contenu et stockage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Type de produit Antibody
Forme Purified
Isotype IgG
Gamme de produits Novus
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.