missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Abnova™ APOA1 (Human) Recombinant Protein
Human APOA1 full-length ORF ( AAH05380, 1 a.a. - 267 a.a.) recombinant protein with GST-tag at N-terminal.
Marke: Abnova™ H00000335-P01.25ug
Additional Details : Gewicht : 0.00010kg
Beschreibung
- Sequence: MKAAVLTLAVLFLTGSQARHFWQQDEPPQSPWDRVKDLATVYVDVLKDSGRDYVSQFEGSALGKQLNLKLLDNWDSVTSTFSKLREQLGPVTQEFWDNLEKETEGLRQEMSKDLEEVKAKVQPYLDDFQKKWQEEMELYRQKVEPLRAELQEGARQKLHELQEKLSPLGEEMRDRARAHVDALRTHLAPYSDELRQRLAARLEALKENGGARLAEYHAKATEHLSTLSEKAKPALEDLRQGLLPVLESFKVSFLSALEEYTKKLNTQ
Spezifikation
| AAH05380 | |
| apolipoprotein A-I | |
| 125% SDS-PAGE Stained with Coomassie Blue | |
| Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
| APOA1 | |
| GST |
| 335 | |
| Wheat germ expression system | |
| 25 μg | |
| MGC117399 | |
| Wheat Germ (in vitro) | |
| 50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer |