missing translation for 'onlineSavingsMsg'
Learn More

glutamate-ammonia ligase (glutamine synthetase), Mouse, Clone: 3B6, Abnova™

Artikelnummer. 16118754
Change view
Click to view available options
Menge:
100 μg
Packungsgröße:
100 Mikrogramm
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Artikelnummer. Menge unitSize
16118754 100 μg 100 Mikrogramm
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Dieser Artikel kann nicht zurückgegeben werden. Rückgaberichtlinie anzeigen
Artikelnummer. 16118754 Lieferant Abnova Lieferanten-Nr. H00002752M02.100ug

om dit product te kopen Registreer vandaag om een webaccount aan te maken

Dieser Artikel kann nicht zurückgegeben werden. Rückgaberichtlinie anzeigen

Mouse monoclonal antibody raised against a partial recombinant GLUL.

Glutamine is a main source of energy and is involved in cell proliferation, inhibition of apoptosis, and cell signaling (Haberle et al., 2005 [PubMed 16267323]). Fetal glutamine requirements are very high and depend largely on active glutamine synthesis and the release of glutamine into the fetal circulation by the placenta. Glutamine synthetase (EC 6.3.1.2), also called glutamate-ammonia ligase (GLUL), is expressed throughout the body and plays an important role in controlling body pH and in removing ammonia from the circulation. The enzyme clears L-glutamate, the major neurotransmitter in the central nervous system, from neuronal synapses (see references in Clancy et al., 1996 [PubMed 8975719]).[supplied by OMIM

Sequence: IEKLSKRHQYHIRAYDPKGGLDNARRLTGFHETSNINDFSAGVANRSASIRIPRTVGQEKKGYFEDRRPSANCDPFSVTEALIRTCLLNETGDEPFQYKN

Spezifikation

Antigen glutamate-ammonia ligase (glutamine synthetase)
Anwendungen ELISA, Western Blot
Klassifikation Monoclonal
Klon 3B6
Konjugat Unconjugated
Beschreibung Mouse monoclonal antibody raised against a partial recombinant GLUL.
Zusammensetzung PBS with no preservative; pH 7.4
Gen GLUL
Gen-Zugriffsnummer NM_002065
Gen-Alias GLNS/GS/PIG43/PIG59
Gensymbole GLUL
Wirtsspezies Mouse
Immunogen GLUL (NP_002056, 274 a.a. ∼ 373 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Reinigungsverfahren Affinity Purified
Menge 100 μg
Regulatorischer Status RUO
Ganzes Molekül Yes
Primär oder sekundär Primary
Gen-ID (Entrez) 2752
Zielspezies Human, Mouse, Rat
Inhalt und Lagerung Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Produkttyp Antibody
Isotype IgG1 κ
Mehr anzeigen Weniger anzeigen
Name des Produkts
Wählen Sie ein Thema

Indem Sie auf Absenden klicken, erklären Sie sich damit einverstanden, dass Fisher Scientific sich mit Ihnen in Verbindung setzen kann, um Ihr Feedback in diesem Formular zu bearbeiten. Wir werden Ihre Informationen nicht für andere Zwecke weitergeben. Alle bereitgestellten Kontaktinformationen werden in Übereinstimmung mit unserer Datenschutzrichtlinie aufbewahrt. Datenschutzrichtlinie.