missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Amphiphysin/AMPH Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Marke: Novus Biologicals NBP1-86033-25ul
This item is not returnable.
View return policy
Description
Amphiphysin/AMPH Polyclonal antibody specifically detects Amphiphysin/AMPH in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/ Immunofluorescence, Immunohistochemistry (Paraffin)
Specifications
| Amphiphysin/AMPH | |
| Polyclonal | |
| Western Blot 0.04-0.4 ug/mL, Immunohistochemistry 1:1000 - 1:2500, Immunocytochemistry/ Immunofluorescence 0.25-2 ug/mL, Immunohistochemistry-Paraffin 1:1000 - 1:2500 | |
| AMPH1, amphiphysin, amphiphysin (Stiff-Man syndrome with breast cancer 128kDa autoantigen), amphiphysin (Stiff-Mann syndrome with breast cancer 128kD autoantigen), amphiphysin I | |
| This antibody was developed against Recombinant Protein corresponding to amino acids: PGFLYKVETLHDFEAANSDELTLQRGDVVLVVPSDSEADQDAGWLVGVKESDWLQYRDLATYKGLFPENFTRRL | |
| 25 μL | |
| Cancer, Immune System Diseases, Immunology, Tumor Suppressors | |
| 273 | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. | |
| IgG |
| Western Blot, Immunohistochemistry, Immunocytochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS (pH 7.2) and 40% Glycerol | |
| Rabbit | |
| Immunogen affinity purified | |
| RUO | |
| Primary | |
| Human | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction