missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Anticorps
  4. Anticorps primaires
  5. Tous les anticorps primaires
  6. ADCK4 Antibody, Novus Biologicals™

ADCK4 Antibody, Novus Biologicals™

Code produit 18229746 Tous les produits Bio Techne Produits
Modifier l'affichage
Click to view available options
Quantité:
25 μL
0.1 mL
Conditionnement:
0.10mL
25µL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Code produit Quantité Conditionnement
18229746 0.1 mL 0.10mL
18467091 25 μL 25µL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Les retours ne sont pas autorisés pour ce produit. Afficher la politique du retour.
Produktkod. 18229746 Leverantör Novus Biologicals Leverantörsnummer NBP185508
  • ONLINE EXCLUSIVE PRICE
    703.45 CHF
    607.95 CHF / 0.1 Milliliter
    Sparen 95.50 CHF
    13% Rabatt
 Article restreint
Verfügbar ab: 02-12-2026
Lägg i varukorgen
Lägg i varukorgen

missing translation for 'validMainframeMsg'

Denna artikel kan inte returneras. Se returpolicy

Beskrivning

Rabbit Polyclonal Antibody

ADCK4 Polyclonal specifically detects ADCK4 in Human, Mouse, Rat samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin), Western Blot.
TRUSTED_SUSTAINABILITY

Specifikationer

Antigène ADCK4
Applications Immunohistochemistry, Immunohistochemistry (Paraffin), Western Blot
Classification Polyclonal
Conjugué Unconjugated
Dilution Western Blot 0.4 ug/ml, Immunohistochemistry 1:500 - 1:1000, Immunohistochemistry-Paraffin 1:500 - 1:1000
Formule PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Alias de gène aarF domain containing kinase 4, COQ8, EC 2.7.11, EC 2.7.11.-, EC 2.7.11.1, EC 2.7.11.25, FLJ12229
Symboles de gène(s) COQ8B
Espèces hôtes Rabbit
Immunogène This antibody was developed against Recombinant Protein corresponding to amino acids:RQSADFMPRWQMLRVLEEELGRDWQAKVASLEEVPFAAASIGQVHQGLLRDGTEVAVKIQY
Méthode de purification Affinity Purified
Quantité 0.1 mL
État réglementaire RUO
Disciplines de recherche Protein Kinase
Primaire ou secondaire Primary
Identification génétique (Entrez) 79934
Spécificité du test Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Espèces cibles Human, Mouse, Rat
Contenu et stockage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Isotype IgG
Visa mer Visa mindre

For Research Use Only

Produkttitel
Välj ett problem

Genom att klicka på Skicka bekräftar du att du kan bli kontaktad av Fisher Scientific angående feedbacken du har lämnat i detta formulär. Vi kommer inte att dela din information för andra ändamål. All kontaktinformation som tillhandahålls ska också underhållas i enlighet med vår Sekretesspolicy.