missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Activin RIIA Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
418.00 CHF - 630.00 CHF
Spezifikation
| Antigen | Activin RIIA |
|---|---|
| Konzentration | 0.1mg/mL |
| Verdünnung | Immunohistochemistry 1:20 - 1:50, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:50-1:200 |
| Anwendungen | Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Klassifikation | Polyclonal |
| Produktcode | Marke | Menge | Preis | Menge & Verfügbarkeit | |||||
|---|---|---|---|---|---|---|---|---|---|
| Produktcode | Marke | Menge | Preis | Menge & Verfügbarkeit | |||||
|
18469171
|
Novus Biologicals
NBP1-91647-25ul |
25 μL |
418.00 CHF
25 Mikroliter |
Log in om dit product te kopen Registreer vandaag om een webaccount aan te maken | |||||
|
18060437
|
Novus Biologicals
NBP1-91647 |
0.1 mL |
630.00 CHF
0.10 Milliliter |
Log in om dit product te kopen Registreer vandaag om een webaccount aan te maken | |||||
Description
Activin RIIA Polyclonal specifically detects Activin RIIA in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
| Activin RIIA | |
| Immunohistochemistry 1:20 - 1:50, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:50-1:200 | |
| Polyclonal | |
| Rabbit | |
| Cancer | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| 92 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids:CEGNMCNEKFSYFPEMEVTQPTSNPVTPKPPYYN | |
| Primary | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| 0.1mg/mL | |
| Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| RUO | |
| Human | |
| activin A receptor, type II, activin A receptor, type IIA, Activin receptor type IIA, activin receptor type-2A, ACTRII, ACTRIIA, ACVR2ACTR-IIA, EC 2.7.11, EC 2.7.11.30 | |
| ACVR2A | |
| IgG | |
| Affinity Purified | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title