missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antikörper
  4. Primärantikörper
  5. Alle Primärantikörper
  6. 16364445

Invitrogen™ ACTH Polyclonal Antibody
GREENER_CHOICE

Artikelnummer. 16364445 Alle ansehen Thermo Scientific Produkte
Change view
Click to view available options
Menge:
100 μg
Packungsgröße:
100 Mikrogramm
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Artikelnummer. Menge unitSize
16364445 100 μg 100 Mikrogramm
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Dieser Artikel kann nicht zurückgegeben werden. Rückgaberichtlinie anzeigen
Artikelnummer. 16364445 Lieferant Invitrogen™ Lieferanten-Nr. PA595177

om dit product te kopen Registreer vandaag om een webaccount aan te maken

Dieser Artikel kann nicht zurückgegeben werden. Rückgaberichtlinie anzeigen

Beschreibung

Rabbit Polyclonal Antibody

Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 μg/mL. Positive Control - IHC: mouse kidney tissue, rat brain tissue, rat kidney tissue. Store at -20°C for one year from date of receipt. After reconstitution, at 4°C for one month. It can also be aliquotted and stored frozen at -20°C for six months. Avoid repeated freeze-thaw cycles.

ATCH (adrenocorticotropic hormone) is a hormone which plays a major role in stimulating the adrenal cortex. It is formed through cleavage of the polypeptide precursor proopiomelanocortin (POMC), which also results in several other cleavage products including MSH, ACTH, and beta endorphin. ATCH is secreted from the anterior pituitary in response to the corticotropin-releasing hormone from the hypothalamus. It stimulates the secretion of glucocorticoids like cortisol, but has little control over the stimulation of mineralocorticoids like aldosterone, which is another major hormone of the adrenal cortex.
TRUSTED_SUSTAINABILITY

Spezifikation

Antigen ACTH
Anwendungen Immunohistochemistry (Paraffin)
Klassifikation Polyclonal
Konzentration 500 μg/mL
Konjugat Unconjugated
Zusammensetzung PBS with 5mg BSA and 0.05mg sodium azide
Gen Pomc
Gen-Zugriffsnummer P01189, P01193, P01194
Gen-Alias ACTH; adrenal corticotropic hormone; adrenocorticotropic hormone; adrenocorticotropin; alpha-melanocyte stimulating hormone; alpha-melanocyte-stimulating hormone; alphaMSH; alpha-MSH; BE; beta-endorphin; Beta-LPH; beta-melanocyte-stimulating hormone; beta-MSH; Clip; Corticotropin; Corticotropin-like intermediary peptide; corticotropin-lipotropin; Gamma-LPH; gamma-MSH; Lipotropin beta; lipotropin gamma; LPH; Melanocyte-stimulating hormone alpha; Melanocyte-stimulating hormone beta; Melanotropin alpha; melanotropin beta; Melanotropin gamma; met-enkephalin; MSH; NPP; opiomelanocortin prepropeptide; OTTHUMP00000119991; OTTHUMP00000200964; POC; Pomc; Pomc1; Pomc-1; Pomc2; Potential peptide; Precursor of MSH; pro-ACTH-endorphin; proopiomelanocortin; pro-opiomelanocortin; proopiomelanocortin (adrenocorticotropin/ beta-lipotropin/ alpha-melanocyte stimulating hormone/ beta-melanocyte stimulating hormone/ beta-endorphin); proopiomelanocortin preproprotein; proopiomelanocortin, beta (endorphin, beta); pro-opiomelanocortin-alpha; proopoimelanocortin, beta (endorphin, beta)
Gensymbole Pomc
Wirtsspezies Rabbit
Immunogen A synthetic peptide corresponding to a sequence in the middle region of human ACTH (138-176aa SYSMEHFRWGKPVGKKRRPVKVYPNGAEDESAEAFPLEF).
Reinigungsverfahren Affinity chromatography
Menge 100 μg
Regulatorischer Status RUO
Primär oder sekundär Primary
Gen-ID (Entrez) 18976, 24664, 5443
Zielspezies Human, Mouse, Rat
Inhalt und Lagerung -20°C
Produkttyp Antibody
Form Lyophilized
Isotype IgG
Mehr anzeigen Weniger anzeigen
Name des Produkts
Wählen Sie ein Thema

Indem Sie auf Absenden klicken, erklären Sie sich damit einverstanden, dass Fisher Scientific sich mit Ihnen in Verbindung setzen kann, um Ihr Feedback in diesem Formular zu bearbeiten. Wir werden Ihre Informationen nicht für andere Zwecke weitergeben. Alle bereitgestellten Kontaktinformationen werden in Übereinstimmung mit unserer Datenschutzrichtlinie aufbewahrt. Datenschutzrichtlinie.