UserName
Rabbit Recombinant Monoclonal Antibody
Rabbit Recombinant Monoclonal Antibody
Rabbit Recombinant Monoclonal Antibody
Testspezifität | Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
---|---|
Gen-Zugriffsnummer | O15516 |
Konjugat | Unconjugated |
Isotype | IgG |
Gensymbole | CLOCK |
Primär oder sekundär | Primary |
Inhalt und Lagerung | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Zusammensetzung | PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide |
Klassifikation | Polyclonal |
Antigen | CLOCK |
Regulatorischer Status | RUO |
Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids:TQDRQIRFSQGQQLVTKLVTAPVACGAVMVPSTMLMGQVVTAYPTFATQQQQSQTLSVTQQQQQQSSQEQQLTSVQQPSQAQLTQPPQQFLQTSRLLHGNPSTQLILSAAFPLQQSTFPQSHHQQHQSQQQQQLSRHRTDSLPD |
Zielspezies | Human |
Wirtsspezies | Rabbit |
Reinigungsverfahren | Affinity Purified |
Anwendungen | Immunohistochemistry,Immunocytochemistry,Immunofluorescence,Immunohistochemistry (Paraffin) |
Verdünnung | Immunohistochemistry 1:200 - 1:500, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:200 - 1:500 |
Gen-Alias | BHLHE8, circadian locomoter output cycles protein kaput, Class E basic helix-loop-helix protein 8, clock (mouse) homolog, clock homolog (mouse), EC 2.3.1.48, hCLOCK, KAT13D, KIAA0334bHLHe8circadian locomoter output cycles kaput protein |
Gen-ID (Entrez) | 9575 |
Rabbit Polyclonal Antibody has been used in 3 publications
Form | Antisera |
---|---|
Gen-Zugriffsnummer | O08785 |
Konjugat | Unconjugated |
Isotype | IgG |
Gensymbole | CLOCK |
Primär oder sekundär | Primary |
Inhalt und Lagerung | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
Zusammensetzung | Whole antisera with 0.05% Sodium Azide |
Klassifikation | Polyclonal |
Antigen | CLOCK |
Regulatorischer Status | RUO |
Immunogen | Two peptides derived from mouse CLOCK conjugated to albumin. [UniProt# O08785] |
Zielspezies | Human,Mouse |
Forschungsgebiet | Chromatin Research, Circadian Rhythm, Neuroscience, Signal Transduction, Transcription Factors and Regulators |
Wirtsspezies | Rabbit |
Reinigungsverfahren | Unpurified |
Anwendungen | Western Blot,ChIP Assay |
Verdünnung | Western Blot 1:1000, Chromatin Immunoprecipitation (ChIP) 1:10-1:500 |
Gen-Alias | BHLHE8, circadian locomoter output cycles protein kaput, Class E basic helix-loop-helix protein 8, clock (mouse) homolog, clock homolog (mouse), EC 2.3.1.48, hCLOCK, KAT13D, KIAA0334bHLHe8circadian locomoter output cycles kaput protein |
Gen-ID (Entrez) | 9575 |
Klon | 8F7 |
---|---|
Form | Ascites |
Konjugat | Unconjugated |
Isotype | IgG1 |
Gensymbole | CLOCK |
Primär oder sekundär | Primary |
Molekulargewicht des Antigens | 95 kDa |
Inhalt und Lagerung | Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze/thaw cycles. |
Klassifikation | Monoclonal |
Antigen | CLOCK |
Regulatorischer Status | RUO |
Immunogen | Purified recombinant fragment of human CLOCK expressed in E. Coli. |
Zielspezies | Human |
Wirtsspezies | Mouse |
Reinigungsverfahren | Unpurified |
Anwendungen | Western Blot |
Verdünnung | Western Blot 1:500-1:2000, ELISA 1:10000, Immunocytochemistry/Immunofluorescence 1:200-1:1000 |
Gen-Alias | BHLHE8, circadian locomoter output cycles protein kaput, Class E basic helix-loop-helix protein 8, clock (mouse) homolog, clock homolog (mouse), EC 2.3.1.48, hCLOCK, KAT13D, KIAA0334bHLHe8circadian locomoter output cycles kaput protein |
Gen-ID (Entrez) | 9575 |
Form | Liquid |
---|---|
Gen-Zugriffsnummer | O15516 |
Konjugat | Unconjugated |
Isotype | IgG |
Gensymbole | CLOCK |
Konzentration | 0.13 mg/mL |
Primär oder sekundär | Primary |
Inhalt und Lagerung | -20°C |
Zusammensetzung | PBS with 50% glycerol and 0.1% sodium azide; pH 7.3 |
Klassifikation | Polyclonal |
Antigen | CLOCK |
Gen | CLOCK |
Regulatorischer Status | RUO |
Immunogen | CLOCK Fusion Protein Ag12826 |
Zielspezies | Human |
Wirtsspezies | Rabbit |
Reinigungsverfahren | Antigen Affinity Chromatography |
Anwendungen | Immunocytochemistry,Immunofluorescence,Western Blot |
Produkttyp | Antibody |
Gen-Alias | bHLHe8, CLOCK, clock homolog (mouse), hCLOCK, KAT13D, KIAA0334 |
Gen-ID (Entrez) | 9575 |
Rabbit Recombinant Monoclonal Antibody
Inhalt und Lagerung | Store at -20°C. Stable for one year after shipment. |
---|---|
Antigen | CLOCK |
Klon | 1I23 |
Form | Liquid |
Zielspezies | Human,Mouse,Rat |
Wirtsspezies | Rabbit |
Isotype | IgG |
Gensymbole | bHLHe8, CLOCK, clock homolog (mouse), hCLOCK, KAT13D, KIAA0334 |
Konzentration | 800 μg/mL |
Anwendungen | Western Blot,Immunohistochemistry,ELISA |
Primär oder sekundär | Primary |
Gen-ID (Entrez) | 9575 |